PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010922920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MYB
Protein Properties Length: 319aa    MW: 36311.6 Da    PI: 6.1771
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010922920.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.41.1e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ + ++G g+W+++++  g+ R++k+c++rw +yl
   XP_010922920.1 14 KGLWSPEEDEKLYNHIMRFGVGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding52.79.5e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E++l++++++ lG++ W+ Ia+ ++ gRt++++k++w++ 
   XP_010922920.1  67 RGSFSQQEEDLIICLHEILGNR-WSQIASQLP-GRTDNEIKNYWNSC 111
                      899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-25664IPR009057Homeodomain-like
PROSITE profilePS5129416.643961IPR017930Myb domain
SuperFamilySSF466894.49E-2912108IPR009057Homeodomain-like
SMARTSM007174.9E-121363IPR001005SANT/Myb domain
PfamPF002492.1E-141461IPR001005SANT/Myb domain
CDDcd001672.13E-101761No hitNo description
PROSITE profilePS5129426.11462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.2E-2665116IPR009057Homeodomain-like
SMARTSM007172.3E-1666114IPR001005SANT/Myb domain
PfamPF002491.7E-1567111IPR001005SANT/Myb domain
CDDcd001676.38E-1169109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGRHSCCLKQ KLRKGLWSPE EDEKLYNHIM RFGVGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGSF SQQEEDLIIC LHEILGNRWS QIASQLPGRT DNEIKNYWNS CLKKKLRQRG  120
IDPSTHKPLS EIEAPVEKPG LNNSSSSGSL EHLPVKPVFD PFPLIDIQAG VDLMETDSNL  180
CSQIQQTFKP FNQNELLTSS GFCDYSSLLD VSENYGYGES SSNSSNWNCN IGTDTNYVLG  240
NEVLNWVSDN KVSSLTQTHN NGVETFEHKI SPWHEKQHHV QSTDDYNSYP MRSLSRDLTE  300
ACLDIPRGEL ASEFNVDFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-29311616128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010922920.10.0PREDICTED: myb-related protein Hv33-like
SwissprotP200274e-87MYB3_HORVU; Myb-related protein Hv33
TrEMBLM0U2H81e-153M0U2H8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P22190_0011e-153(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.32e-80myb domain protein 55